Description

  • Product name

    Recombinant Human Psoriasin protein
    See all Psoriasin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab105577 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSNTQAERSIIGMIDMFHKYTRRDDKIDKP SLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLG DIATDYHKQSHGAAPCSGGSQ
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      1 to 101
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • HID 5
    • Protein S100 A7
    • Protein S100-A7
    • PSOR 1
    • PSOR1
    • Psoriasin
    • Psoriasin 1
    • Psoriasin1
    • S100 Calcium binding protein A7
    • S100 calcium-binding protein A7
    • S100A7
    • S100A7c
    • S10A7_HUMAN
    see all
  • Tissue specificity

    Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Secreted by a non-classical secretory pathway.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab105577 (3ug)
  • Anti-Psoriasin antibody (ab83534) at 1 µg/ml + Recombinant Human Psoriasin protein (ab105577) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 1 minute

References

ab105577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up