Description

  • Product name

    Recombinant Human PTBP1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGD SRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIE MNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAA LQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVL HQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNAC CTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGAP GIISASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAG RIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKK ENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQEDQ GLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLF SSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRV SFSKSTI
    • Predicted molecular weight

      87 kDa including tags
    • Amino acids

      1 to 557

Specifications

Our Abpromise guarantee covers the use of ab131990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 57 kDa RNA binding protein PPTB 1
    • 57 kDa RNA-binding protein PPTB-1
    • Heterogeneous nuclear ribonucleoprotein I
    • Heterogeneous Nuclear Ribonucleoprotein Polypeptide I
    • hnRNP I
    • HNRNP-I
    • HNRNPI
    • HNRPI
    • MGC10830
    • MGC8461
    • Polypyrimidine tract binding protein
    • Polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoprotein I)
    • Polypyrimidine Tract Binding Protein 1
    • Polypyrimidine tract-binding protein 1
    • pPTB
    • PTB
    • PTB 1
    • PTB 2
    • PTB 3
    • PTB 4
    • PTB T
    • PTB1
    • PTB2
    • PTB3
    • PTB4
    • PTBP 1
    • PTBP1
    • PTBP1_HUMAN
    • PTBT
    • RNA Binding Protein
    see all
  • Function

    Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA.
  • Sequence similarities

    Contains 4 RRM (RNA recognition motif) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE using ab131990 stained with Coomassie Blue.

References

ab131990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up