Overview

  • Product name
    Recombinant Human PTCH2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTARQEGENILT PEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIE KLFPCVILTP
    • Amino acids
      79 to 188
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • patched (Drosophila) homolog 2
    • patched homolog 2 (Drosophila)
    • Protein patched homolog 2
    • PTC2
    • PTC2_HUMAN
    • Ptch2
    see all
  • Function
    May have a role in epidermal development. May act as a receptor for Sonic hedgehog (SHH).
  • Involvement in disease
    Defects in PTCH2 are a cause of medulloblastoma (MDB) [MIM:155255]. MDB is a malignant, invasive embryonal tumor of the cerebellum with a preferential manifestation in children. Although the majority of medulloblastomas occur sporadically, some manifest within familial cancer syndromes such as Turcot syndrome and basal cell nevus syndrome (Gorlin syndrome).
    Defects in PTCH2 are a cause of sporadic basal cell carcinoma (BCC) [MIM:605462].
  • Sequence similarities
    Belongs to the patched family.
    Contains 1 SSD (sterol-sensing) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160134 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up