Description

  • Product name

    Recombinant Human PTGER3 protein
    See all PTGER3 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSV SVAFPITMLLTGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDL VGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASA MAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYT VQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNL ATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLR KILLRKFCQVANAVSSCSNDGQKGQPISLSNEIIQTEA
    • Amino acids

      1 to 388
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EP 3
    • EP3
    • EP3 I
    • EP3 II
    • EP3 III
    • EP3 IV
    • Ep3 prostanoid receptor
    • Ep3 receptor
    • EP3 subtype
    • EP3e
    • HGNC:9595
    • MGC141828
    • MGC141829
    • MGC27302
    • PE2R3_HUMAN
    • PGE receptor EP3 subtype
    • PGE2 R
    • PGE2 receptor EP3 subtype
    • PGE2-R
    • PGE2R
    • Pgerep3
    • Prostaglandin E receptor 3
    • Prostaglandin E receptor 3 (subtype EP3)
    • Prostaglandin E receptor EP3 subtype 3 isoform
    • Prostaglandin E2 receptor
    • Prostaglandin e2 receptor ep3
    • Prostaglandin E2 receptor EP3 subtype
    • Prostaglandin receptor (PGE 2)
    • Prostaglandin receptor 3, EP3, subtype
    • Prostanoid EP3 receptor
    • PTGER 3
    • Ptger3
    • Ptgerep3
    • Rep3
    • rEP3a
    • rEP3b
    see all
  • Function

    Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.
  • Tissue specificity

    Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab159274 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up