Description

  • Product name

    Recombinant Human PTGES2/Gbf1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab107954 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKAVNEQGKEVTEFGNKYWLMLNEKEAQQV YGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFG AVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKD RPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAIT EASPAH
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 206
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PTGES2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • C9orf15
    • FLJ14038
    • Gamma interferon activated transcriptional element binding factor 1
    • GATE binding factor 1
    • GBF 1
    • GBF1
    • Membrane associated prostaglandin E synthase 2
    • MGC11289
    • Microsomal prostaglandin E synthase 2
    • mPGES 2
    • mPGES-2
    • PGES2
    • PGES2_HUMAN
    • Prostaglandin E synthase 2
    • Prostaglandin E synthase 2 truncated form
    • PTGES 2
    • PTGES2
    see all
  • Function

    Isomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form. May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear.
  • Tissue specificity

    Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, frontal and parietal lobes. Also expressed in the lymph nodes, skeletal muscle, kidney and trachea, but not in the thymus or lung. Overexpressed in colorectal cancer.
  • Pathway

    Lipid metabolism; prostaglandin biosynthesis.
  • Sequence similarities

    Belongs to the GST superfamily.
    Contains 1 glutaredoxin domain.
    Contains 1 GST C-terminal domain.
  • Cellular localization

    Golgi apparatus membrane and Cytoplasm > perinuclear region. Synthetized as a Golgi membrane-bound protein, which is further cleaved into the predominant soluble truncated form. The truncated form is cytoplasmic and is enriched in the perinuclear region.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab107954 (3 µg).

References

ab107954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up