Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNHKVHHHHHHMEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPK NKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLP NTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTN LKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPA SFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRK DPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQD QWKELSHEDLEPPPEHIPPPPRPPK RILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESM SQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMC VATVLTAGAYLCYRFLFNSNTVDLQSR
    • Molecular weight
      50 kDa
    • Amino acids
      1 to 435
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.3% Tris

General Info

  • Alternative names
    • PTP1B
    • Non receptor tyrosine phosphatase 1
    • Protein phosphotyrosylphosphatase 1B
    • Protein tyrosine phosphatase 1B
    • Protein tyrosine phosphatase non receptor type 1
    • Protein tyrosine phosphatase placental
    • Protein-tyrosine phosphatase 1B
    • PTN1_HUMAN
    • PTP 1B
    • PTP-1B
    • PTPN 1
    • PTPN1
    • Tyrosine protein phosphatase non receptor type 1
    • Tyrosine-protein phosphatase non-receptor type 1
    see all
  • Function
    May play an important role in CKII- and p60c-src-induced signal transduction cascades.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications
    Oxidized on Cys-215; the Cys-SOH formed in response to redox signaling reacts with the alpha-amido of the following residue to form a 4-amino-3-isothiazolidinone serine cross-link, triggering a conformational change that inhibits substrate binding and activity. The active site can be restored by reduction.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

References

ab172824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up