Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      NRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYD KAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHC VAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRP KMRLRFRDTNGHCCVQ
    • Molecular weight

      19 kDa including tags
    • Amino acids

      2 to 167
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    0.334U/µg. One unit will hydrolyze 1pmol para-nitrophenyl phosphate (PNPP) per minute at 37°C. Assay buffer: 50mM TRIS, pH 7.4, containing 150mM sodium chloride, 5mM dithiothreitol and 12.5mM PNPP.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    0.334U/µg. One unit will hydrolyze 1pmol para-nitrophenyl phosphate (PNPP) per minute at 37°C. Assay buffer: 50mM TRIS, pH 7.4, containing 150mM sodium chloride, 5mM dithiothreitol and 12.5mM PNPP.

     This product was previously labelled as PTP4A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.05% DTT, 0.39% Tris HCl, 0.05% Tween, 20% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BM 008
    • EC 3.1.3.48
    • HH 13
    • HH13
    • HH7 2
    • HU PP 1
    • HUPP 1
    • HUPP1
    • OV 1
    • OV1
    • phosphatase of regenerating liver 2
    • PRL 2
    • PRL2
    • Protein tyrosine phosphatase 4a2
    • protein tyrosine phosphatase IVA
    • protein tyrosine phosphatase IVA2
    • Protein tyrosine phosphatase of regenerating liver 2
    • protein tyrosine phosphatase type IVA 2
    • Protein tyrosine phosphatase type IVA member 2 isoform 1
    • protein tyrosine phosphatase type IVA, member 2
    • PTP (CAAXII)
    • ptp IV1a
    • ptp IV1b
    • PTP4A
    • PTPCAAX2
    • TP4A2_HUMAN
    see all
  • Relevance

    Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue.
  • Cellular localization

    Cell Membrane, Early Endosome and Cytoplasm.

References

ab157062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up