Description

  • Product name

    Recombinant Human PTP4A2/PRL2 protein
    See all PTP4A2/PRL2 proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYD KAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHC VAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRP KMRLRFRDTNGHC
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      2 to 164
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 2 to 164. The propeptide is not included (AAH70182).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab201376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as PTP4A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BM 008
    • EC 3.1.3.48
    • HH 13
    • HH13
    • HH7 2
    • HU PP 1
    • HUPP 1
    • HUPP1
    • OV 1
    • OV1
    • phosphatase of regenerating liver 2
    • PRL 2
    • PRL2
    • Protein tyrosine phosphatase 4a2
    • protein tyrosine phosphatase IVA
    • protein tyrosine phosphatase IVA2
    • Protein tyrosine phosphatase of regenerating liver 2
    • protein tyrosine phosphatase type IVA 2
    • Protein tyrosine phosphatase type IVA member 2 isoform 1
    • protein tyrosine phosphatase type IVA, member 2
    • PTP (CAAXII)
    • ptp IV1a
    • ptp IV1b
    • PTP4A
    • PTPCAAX2
    • TP4A2_HUMAN
    see all
  • Relevance

    Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue.
  • Cellular localization

    Cell Membrane, Early Endosome and Cytoplasm.

Images

  • DTT-reduced SDS-PAGE analysis of ab201376 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 46 kDa in SDS-PAGE .

References

ab201376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up