Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPT ATGEKEENVKKNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGP KAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGRKKCERYWPLY GEDPITFAPFKISCEDEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDH DVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNL LKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL YEIHGAQKIADGVNEINTENMISSIEPEKQDSPPPKPPRTRSCLVEGDAK EEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQ HSADLNRNYSKSTELPGKNESTIEQIDKKLERNLSFEIKKVPLQEGPKSF DGNTLLNRGHAIKIKSASPCIADKISKPQELSSDLNVGDTSQNSCVDCSV TQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDL SEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNP LHSDDSDSDERNSDGAVTQNKTNISTASATVSAATSTESISTRKVLPMSI ARHNIAGTTHSGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWS ELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQI SENPTEATDIGFGNRCGKPKGPRDPPSEWT
    • Molecular weight

      115 kDa including tags
    • Amino acids

      1 to 780

Specifications

Our Abpromise guarantee covers the use of ab132054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Protein tyrosine phosphatase G1
    • Protein tyrosine phosphatase non receptor type 12
    • Protein-tyrosine phosphatase G1
    • PTN12_HUMAN
    • PTP PEST
    • PTP-PEST
    • PTPG1
    • Ptpn12
    • Tyrosine protein phosphatase non receptor type 12
    • Tyrosine-protein phosphatase non-receptor type 12
    see all
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 4 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132054 stained with Coomassie Blue.

References

ab132054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up