Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNR YKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTT LLDF
    • Amino acids
      10 to 113
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hematopoietic cell protein tyrosine phosphatase 70Z PEP
    • Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
    • Lymphoid phosphatase
    • Lymphoid specific protein tyrosine phosphatase
    • lymphoid-specific, inducible human protein tyrosine phosphatase
    • LyP
    • Lyp 1
    • Lyp 2
    • Lyp1
    • Lyp2
    • LyPTP
    • OTTHUMP00000013720
    • OTTHUMP00000013721
    • OTTHUMP00000233450
    • OTTHUMP00000233451
    • PEP
    • PEST-domain phosphatase
    • Protein tyrosine phosphatase non receptor type 22
    • Protein tyrosine phosphatase non receptor type 22 (lymphoid)
    • Protein tyrosine phosphatase non receptor type 8
    • Protein tyrosine phosphatase non receptor type 8, formerly
    • PTN22_HUMAN
    • PTPN 22
    • PTPN 8
    • Ptpn22
    • PTPN8
    • PTPN8, formerly
    • Tyrosine-protein phosphatase non-receptor type 22
    see all
  • Function
    Seems to act on Cbl. May play a role in regulating the function of Cbl and its associated protein kinases. Acts as negative regulator of T cell receptor (TCR) signaling. Dephosphorylates and inactivates the SRC family kinases.
  • Tissue specificity
    Predominantly expressed in lymphoid tissues and cells. Isoform 1 is expressed in thymocytes and both mature B and T-cells.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 4 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications
    Phosphorylation on Ser-35 by PKC/PRKCD abrogates its ability to dephosphorylate and inactivate the SRC family kinases.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161921 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up