Overview

  • Product name
    Recombinant Human PTPRN2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ELADLPKTYLRRPEASSPARPSKHSVGSERRYSREGGAALANALRRHLPF LEALSQAPASDVLARTHTAQDRPPAEGDDRFSESILTYVAHTSALTYPPG PRTQL
    • Amino acids
      108 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IA 2beta
    • IA2beta
    • IAR
    • IAR/receptor like protein tyrosine phosphatase
    • ICAAR
    • Islet cell autoantigen related protein
    • Islet cell autoantigen-related protein
    • Phogrin
    • Protein tyrosine phosphatase receptor pi
    • Protein tyrosine phosphatase, receptor type, N polypeptide 2
    • PTPR2_HUMAN
    • Ptprn2
    • PTPRP
    • R PTP N2
    • R-PTP-N2
    • Receptor-type tyrosine-protein phosphatase N2
    • Tyrosine phosphatase IA 2 beta
    see all
  • Function
    Implicated in development of nervous system and pancreatic endocrine cells.
  • Tissue specificity
    Highest levels in brain and pancreas. Lower levels in trachea, prostate, stomach and spinal chord.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Receptor class 8 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Domain
    The cytoplasmic domain appears to contain the autoantigenic epitopes.
  • Post-translational
    modifications
    Appears to undergo multiple proteolytic cleavage at consecutive basic residues.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159288 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up