Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFET IEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP
    • Molecular weight

      37 kDa including tags
    • Amino acids

      31 to 128
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Protein tyrosine phosphatase PTPsigma
    • Protein tyrosine phosphatase receptor type S
    • Protein tyrosine phosphatase receptor type sigma
    • Ptprs
    • PTPRS_HUMAN
    • PTPSIGMA
    • R PTP sigma
    • R-PTP-S
    • R-PTP-sigma
    • Receptor-type tyrosine-protein phosphatase S
    • Receptor-type tyrosine-protein phosphatase sigma
    see all
  • Function

    Interacts with LAR-interacting protein LIP.1.
  • Tissue specificity

    Detected in all tissues tested except for placenta and liver.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 2A subfamily.
    Contains 8 fibronectin type-III domains.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 tyrosine-protein phosphatase domains.
  • Post-translational
    modifications

    A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132588 stained with Coomassie Blue.

References

ab132588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up