Recombinant Human PU.1/Spi1 protein (ab152701)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH HVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPS LGHQVSYLPRMCLQYPSLSP
    • Molecular weight
      39 kDa including tags
    • Amino acids
      7 to 126

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.<
  • Concentration information loading...
  • Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names
      • transcription factor spi1
      • 31 kDa Transforming Protein
      • 31 kDa-transforming protein
      • cb1086
      • Hematopoietic transcription factor PU.1
      • OF
      • oncogene spi1
      • PU.1
      • SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of
      • SFPI1
      • si:by184l24.2
      • SPI 1
      • SPI 1 proto oncogene
      • SPI A
      • Spi1
      • SPI1_HUMAN
      • Spleen focus forming virus (SFFV) proviral integration oncogene spi1
      • Spleen focus forming virus proviral integration oncogene spi1
      • Transcription factor PU.1
      see all
    • Function
      Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.
    • Sequence similarities
      Belongs to the ETS family.
      Contains 1 ETS DNA-binding domain.
    • Cellular localization
      Nucleus.
    • Information by UniProt

    Images

    • 12.5% SDS-PAGE analysis of ab157012 stained with Coomassie Blue.

    References

    ab152701 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab152701.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Get resources and offers direct to your inbox Sign up