For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-pu1spi1-protein-his-tag-ab236335.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)
  • Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)
  • Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 85% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: MS, SDS-PAGE

You may also be interested in

Protein
Product image
Recombinant E. coli SSB protein (ab123224)
Protein
Product image
Recombinant Aculeacin-A acylase protein (Tagged) (ab236805)
Protein
Product image
Recombinant Ovomucoid protein (Tagged) (ab236918)

View more associated products

Description

  • Product name

    Recombinant Human PU.1/Spi1 protein (His tag)
    See all PU.1/Spi1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

    P17947
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHY WDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPM VPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEA DGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQ FSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTY QFSGEVLGRGGLAERRHPPH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      1 to 270
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-PU.1/Spi1 antibody [EPR3158Y] - BSA and Azide free (ab232383)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-PU.1/Spi1 antibody [EPR3158Y] (ab76543)
    • Anti-PU.1/Spi1 antibody [2G1] (ab88082)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab236335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.2
    Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

General Info

  • Alternative names

    • transcription factor spi1
    • 31 kDa Transforming Protein
    • 31 kDa-transforming protein
    • cb1086
    • Hematopoietic transcription factor PU.1
    • OF
    • oncogene spi1
    • PU.1
    • SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of
    • SFPI1
    • si:by184l24.2
    • SPI 1
    • SPI 1 proto oncogene
    • SPI A
    • Spi1
    • SPI1_HUMAN
    • Spleen focus forming virus (SFFV) proviral integration oncogene spi1
    • Spleen focus forming virus proviral integration oncogene spi1
    • Transcription factor PU.1
    see all
  • Function

    Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P17947 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)
    SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)

    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) ananlysis with 5% enrichment gel and 15% separation gel of ab236335.

  • Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)
    Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)

    Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

  • Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)
    Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (ab236335)

    Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab236335? Please let us know so that we can cite the reference in this datasheet.

ab236335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab236335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.