Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHY WDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPM VPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEA DGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQ FSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTY QFSGEVLGRGGLAERRHPPH
    • Molecular weight

      35 kDa including tags
    • Amino acids

      1 to 270
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab236335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • transcription factor spi1
    • 31 kDa Transforming Protein
    • 31 kDa-transforming protein
    • cb1086
    • Hematopoietic transcription factor PU.1
    • OF
    • oncogene spi1
    • PU.1
    • SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of
    • SFPI1
    • si:by184l24.2
    • SPI 1
    • SPI 1 proto oncogene
    • SPI A
    • Spi1
    • SPI1_HUMAN
    • Spleen focus forming virus (SFFV) proviral integration oncogene spi1
    • Spleen focus forming virus proviral integration oncogene spi1
    • Transcription factor PU.1
    see all
  • Function

    Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) ananlysis with 5% enrichment gel and 15% separation gel of ab236335.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

References

ab236335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up