Description

  • Product name

    Recombinant Human PUS1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLKSGGDEERR EKPPKRKIVLLMAYSGKGYHGMQRNVGSSQFKTIEDDLVSALVRSGCIPE NHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILEKINSHLPSHI RILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAET LQQVNRLLACYKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLE FAVIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKA PGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTII GTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD
    • Amino acids

      1 to 399
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A730013B20Rik
    • DOBI
    • MGC112655
    • MGC11268
    • MLASA
    • MLASA1
    • mPus1p
    • Pseudouridine synthase 1
    • Pseudouridylate synthase 1
    • PUS1
    • tRNA pseudouridine synthase A, mitochondrial
    • tRNA pseudouridine(38-40) synthase
    • tRNA pseudouridylate synthase I
    • tRNA uridine isomerase I
    • tRNA-uridine isomerase I
    • TRUA_HUMAN
    see all
  • Function

    Converts specific uridines to PSI in a number of tRNA substrates. Acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Involved in regulation of nuclear receptor activity possibly through pseudouridylation of SRA1 RNA.
  • Tissue specificity

    Widely expressed. High levels of expression found in brain and skeletal muscle.
  • Involvement in disease

    Defects in PUS1 are a cause of myopathy with lactic acidosis and sideroblastic anemia type 1 (MLASA1) [MIM:600462]; also known as mitochondrial myopathy and sideroblastic anemia. MLASA is a rare autosomal recessive oxidative phosphorylation disorder specific to skeletal muscle and bone marrow.
  • Sequence similarities

    Belongs to the tRNA pseudouridine synthase TruA family.
  • Cellular localization

    Mitochondrion and Nucleus.
  • Information by UniProt

Images

  • ab164258 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up