Description

  • Product name

    Recombinant Human PZP protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIY VPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYG AGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAV NSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVEL TMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSE QLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVL FAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      603 to 829
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab224853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Pregnancy zone protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • A1m
    • C3 and PZP like alpha-2 macroglobulin domain containing protein 6
    • Complement component 3 and pregnancy zone protein like alpha 2 macroglobulin domain containing protein 6
    • CPAMD6
    • Pregnancy zone protein
    • PZP
    • PZP, alpha 2 macroglobulin like
    see all
  • Relevance

    Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
  • Cellular localization

    Secreted

Images

  • SDS-PAGE - Recombinant Human PZP (His tag) (ab224853) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224853 with 5% enrichment gel and 15% separation gel.

References

ab224853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up