Description

  • Product name

    Recombinant Human QPRT protein
  • Purity

    > 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDAEGLALLLPPVTLAALVDSWLREDCPGL NYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEGSK LVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGW TGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG VEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELH PTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      1 to 297
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • NADC_HUMAN
    • Nicotinate nucleotide pyrophosphorylase (carboxylating)
    • Nicotinate-nucleotide pyrophosphorylase [carboxylating]
    • QAPRTase
    • QPRT
    • QPRTase
    • Quinolinate phosphoribosyltransferase
    • Quinolinate phosphoribosyltransferase [decarboxylating]
    see all
  • Function

    Involved in the catabolism of quinolinic acid (QA).
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinate D-ribonucleotide from quinolinate: step 1/1.
  • Sequence similarities

    Belongs to the nadC/modD family.
  • Information by UniProt

Images

  • ab100986 at 3 µg being analysed by 15% SDS PAGE.

References

ab100986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab100986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up