Overview

  • Product name

    Recombinant Human Rab25 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFS TRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTY AVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARMFAENNGLL FLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQE PGPGEKRACCISL
    • Molecular weight

      50 kDa including tags
    • Amino acids

      1 to 213

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CATX 8
    • CATX-8
    • CATX8
    • RAB11C
    • RAB25
    • RAB25 member RAS oncogene family
    • RAB25_HUMAN
    • Ras related protein Rab 25
    • Ras-related protein Rab-25
    • RP11-336K24.10-001
    see all
  • Function

    Involved in the regulation of cell survival. Promotes invasive migration of cells in which it functions to localize and maintain integrin alpha-V/beta-1 at the tips of extending pseudopodia (PubMed:17925226). Involved in the regulation of epithelial morphogenesis through the control of CLDN4 expression and localization at tight junctions (By similarity). May selectively regulate the apical recycling pathway. Together with MYO5B regulates transcytosis.
  • Tissue specificity

    Expressed in ovarian epithelium (NOE) and breast tissue. Expressed in ovarian cancer; expression is increased relative to NOE cells. Expression in ovarian cancer is stage dependent, with stage III and stage IV showing higher levels than early stage cancers. Expressed in breast cancer; expression is increased relative to normal breast tissue.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane. Cell projection, pseudopodium membrane. Cytoplasmic vesicle. Colocalizes with integrin alpha-V/beta-1 in vesicles at the pseudopodial tips.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131892 stained with Coomassie Blue.

References

ab131892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up