Description

  • Product name

    Recombinant Human RAB26 protein
  • Purity

    > 90 % SDS-PAGE.
    ab211931 was expressed in E.coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFSRKKTPKSKGASTPAASTLPT ANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVGDS GVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAG QERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVAL MLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIA KELKRRSMKAPSEPRFRLHDYVKREGRGASCCRP
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      2 to 256
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      T7-His-TEV cleavage site tag (29aa) at N-terminus. (NP_055168).

Specifications

Our Abpromise guarantee covers the use of ab211931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, sucrose, and DTT.

General Info

  • Alternative names

    • CATX-8
    • RAB11c
    • Rab26
    • RAB26 member RAS oncogene family
    • RAB26_HUMAN
    • Ras related oncogene protein
    • Ras related protein Rab 26
    • Ras-associated protein Rab26
    • Ras-related protein Rab-26
    • V46133
    see all
  • Function

    Participates in exocrine secretion: regulates the secretion of acinar granules in the parotid gland.
  • Tissue specificity

    Predominantly expressed in brain.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab211931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up