Overview

  • Product name

    Recombinant Human RAB29 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQ WSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQ RWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTG WTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSW SCC
    • Amino acids

      1 to 203
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp686P1051
    • Rab 7 like protein 1
    • RAB 7L
    • Rab-7-like protein 1
    • RAB29
    • Rab7 like protein 1
    • RAB7 member RAS oncogene family like 1
    • RAB7L
    • RAB7L_HUMAN
    • Ras related protein Rab 7L1
    • Ras related protein Rab7L1
    • Ras-related protein Rab-29
    • Ras-related protein Rab-7L1
    see all
  • Function

    Rab GTPase key regulator in vesicle trafficking. Essential for maintaining the integrity of the endosome-trans-Golgi network structure. Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner. Regulates neuronal process morphology in the intact central nervous system (CNS). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications

    In case of Salmonella enterica serovar Typhimurium (S.Typhimurium) infection, is proteolytically cleaved between Gly-41 and Val-42 by the GtgE viral protease encoded on the Gifsy-2 lysogen bacteriophage, which therefore prevents the recruitment of RAB29 to S.Typhimurium-containing vacuoles. In contrast, no proteolytically cleavage is detected in S.Typhi-infected cells (PubMed:22042847).
  • Cellular localization

    Cell membrane. Cytoplasm. Cytoplasm, perinuclear region. Golgi apparatus. Golgi apparatus, trans-Golgi network. Vacuole. Cytoplasm, cytoskeleton. Colocalizes with LRRK2 along tubular structures emerging from Golgi apparatus (By similarity). Colocalizes with GM130 at the Golgi apparatus. Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus. Colocalizes with TGN46 at the trans-Golgi network (TGN). In Salmonella enterica serovar Typhi (S.Typhi) infected epithelial cells, is recruited and colocalized with both S.Typhi-containing vacuoles and dynamic tubules as well as those emerging from the vacuole toward the cell periphery.
  • Information by UniProt

Images

  • ab160266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up