Description

  • Product name

    Recombinant Human RAB38 protein
  • Purity

    > 90 % SDS-PAGE.
    Expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFQAPHKEHLYKLLVIGDLGVGK TSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERF GNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSV VLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRC LVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      2 to 211
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. (NP_071732).

Specifications

Our Abpromise guarantee covers the use of ab211960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab211960 may be used for in vitro RAB38 protein mediated transporting of integral membrane proteins to lysosomes pathway regulation for cancer cells study by intracellular delivery of this protein; it may be used for mapping RAB38 protein-protein interaction assay; as antigen for specific antibody production.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

General Info

  • Alternative names

    • Antigen NY MEL 1
    • Melanoma antigen NY MEL 1
    • Melanoma antigen NY-MEL-1
    • NY MEL 1
    • RAB 38
    • Rab related GTP binding protein
    • Rab38
    • RAB38 member RAS oncogene family
    • RAB38_HUMAN
    • Ras related protein Rab 38
    • Ras-related protein Rab-38
    • rrGTPbp
    see all
  • Function

    May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.
  • Tissue specificity

    Expressed in melanocytes.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications

    Although at least one in vitro system can process and methylate the prenylated C-terminal, in an in vitro system that normally express Rab-38 and in vivo the prenylated C-terminal is not proteolytically processed and not methylated.
  • Cellular localization

    Cell membrane. Melanosome.
  • Information by UniProt

References

ab211960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up