Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV EIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNV HEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYI ETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHS SEEVVKSERRCLC
    • Amino acids
      1 to 213
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6330580M05Rik
    • MRX72
    • OTTHUMP00000024247
    • OTTMUSP00000020441
    • RAB39B, member RAS oncogene family
    • Ras related protein Rab 39B
    • RAS-associated protein RAB39B
    • RP13-228J13.2
    • RP23-252K7.1
    see all
  • Relevance
    RAB39B is a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking.
  • Cellular localization
    Cell membrane; Lipid-anchor; Cytoplasmic side

Images

  • ab165109 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up