Description

  • Product name

    Recombinant Human Rab3A protein
    See all Rab3A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab109964 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMASATDSRYGQKESSDQNFDYMFKILIIGN SSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAG QERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQV LLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV DVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 220
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.058% Sodium chloride

General Info

  • Alternative names

    • Rab 3A
    • RAB 3A member RAS oncogene family
    • Rab3a
    • RAB3A member RAS oncogene family
    • RAB3A_HUMAN
    • RAS associated protein RAB 3A
    • RAS associated protein RAB3A
    • Ras related protein Rab 3A
    • Ras related protein Rab3A
    • Ras-related protein Rab-3A
    see all
  • Function

    Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
  • Tissue specificity

    Specifically expressed in brain.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab109964.

References

ab109964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up