Description

  • Product name

    Recombinant Human Rab3D protein
  • Purity

    > 90 % SDS-PAGE.
    ab109943 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGN SSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQV ILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 219
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.116% Sodium chloride

General Info

  • Alternative names

    • D2-2
    • Glioblastoma overexpressed
    • GOV
    • RAB 16
    • RAB16
    • Rab3d
    • Rab3D upregulated with myeloid differentiation
    • RAB3D, member RAS oncogene family
    • RAB3D_HUMAN
    • RAD3D
    • Ras-related protein Rab-3D
    see all
  • Function

    Protein transport. Probably involved in regulated exocytosis.
  • Tissue specificity

    Highly expressed in granulocytes of peripheral blood. Constitutively expressed at low levels in all hematopoietic cell lines investigated.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab109943.

References

ab109943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up