Description

  • Product name

    Recombinant Human Rab4 protein
    See all Rab4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab109957 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSQTAMSETYDFLFKFLVIGNAGTGKSCLL HQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTR SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDL DADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES GELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 218
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% DTT

General Info

  • Alternative names

    • HRES 1 / RAB4
    • Oncogene RAB4
    • Rab 4
    • RAB 4A
    • RAB4 member RAS oncogene family
    • Rab4a
    • RAB4A member RAS oncogene family
    • RAB4A_HUMAN
    • Ras related protein Rab 4A
    • Ras related protein Rab4A
    • Ras-related protein Rab-4A
    see all
  • Function

    Protein transport. Probably involved in vesicular traffic.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications

    Phosphorylated by CDK1 kinase during mitosis.
  • Cellular localization

    Membrane. Cytoplasm. Generally associated with membranes. Cytoplasmic when phosphorylated by CDK1.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109957 at approximately 26.5 kDa (3µg).

References

ab109957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up