Overview

  • Product name
    Recombinant Human RAB40B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGID YKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRW SFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGV TFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAV VSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHK RSSLRKVKLVRPPQSPPKNCTRNSCKIS
    • Amino acids
      1 to 278
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ42385
    • GTP binding protein homologous to Saccharomyces cerevisiae SEC4
    • RAB40B member RAS oncogene family
    • RAR
    • Rar protein
    • Ras related protein Rab 40B
    • RP23 293H17.2
    • SEC4L
    • SOCS box containing protein RAR
    see all
  • Relevance
    RAB40B is similar to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. It may be a substrate recognition component of a SCF like ECS (Elongin Cullin SOCS box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Cellular localization
    Cell membrane; Lipid anchor; Cytoplasmic side

Images

  • ab161221 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up