Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGI YWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLS AVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAV ATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGF LAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLK IIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL LGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
    • Amino acids
      1 to 331
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Geranylgeranyl transferase type 2 subunit beta
    • Geranylgeranyl transferase type II subunit beta 3
    • GGTase II beta
    • GGTB
    • Rab geranyl geranyltransferase subunit beta
    • Rab geranylgeranyltransferase beta subunit
    • Rab geranylgeranyltransferase subunit beta
    • Rab GG transferase beta
    • Rab GGTase beta
    • Type II protein geranyl geranyltransferase subunit beta
    • Type II protein geranylgeranyltransferase subunit beta
    see all
  • Relevance
    RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Images

  • ab159298 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up