Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVH ELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVAC GSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAE RLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEII SKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFS IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW SHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFC SVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 384

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Rad51L1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DNA repair protein RAD51 homolog 2
    • hREC2
    • MGC34245
    • OTTHUMP00000212251
    • OTTHUMP00000212253
    • OTTHUMP00000212254
    • OTTHUMP00000212255
    • R51H2
    • RA51B_HUMAN
    • RAD51 homolog B
    • RAD51 homolog B (S. cerevisiae)
    • RAD51 like 1
    • RAD51 like protein 1
    • RAD51-like protein 1
    • Rad51B
    • RAD51L1
    • REC2
    • RecA like protein
    • Recombination repair protein
    see all
  • Function

    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. The RAD51B-RAD51C dimer exhibits single-stranded DNA-dependent ATPase activity. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
  • Tissue specificity

    Expressed in a wide range of tissues.
  • Involvement in disease

    Note=A chromosomal aberration involving RAD51L1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with HMGA1.
    Note=A chromosomal aberration involving RAD51L1 is found in uterine leiomyoma. Translocation t(12;14)(q15;q23-24) with HMGA2.
  • Sequence similarities

    Belongs to the RecA family. RAD51 subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131933 stained with Coomassie Blue.

References

ab131933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up