Description

  • Product name

    Recombinant Human Rad6 protein
    See all Rad6 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFED GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTY DVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWR DC
    • Predicted molecular weight

      17 kDa
    • Amino acids

      1 to 152

Specifications

Our Abpromise guarantee covers the use of ab207955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Immunohistochemistry methylmethacrylate sections

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • BHR6A
    • hHR6A
    • HR6A
    • mHR6A
    • MRXS30
    • MRXSN
    • RAD6 homolog A
    • RAD6A
    • UBC2
    • UBCD6
    • UBE2A
    • Ube2a ubiquitin-conjugating enzyme E2A
    • UBE2A_HUMAN
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein A
    • Ubiquitin conjugating enzyme E2 17 kDa
    • Ubiquitin conjugating enzyme E2 21.5 kDa
    • Ubiquitin conjugating enzyme E2A
    • Ubiquitin conjugating enzyme E2A (RAD6 homolog)
    • Ubiquitin protein ligase A
    • Ubiquitin-conjugating enzyme E2 A
    • Ubiquitin-protein ligase A
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11', as well as 'Lys-48'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207955 (5 µg), Coomassie-stained.

References

ab207955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up