Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVS ESSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEE DMNNGSFSI
    • Amino acids
      150 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RAD9 homolog B. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell cycle checkpoint control protein RAD9B
    • Cell cycle checkpoint control protein RAD9B homolog
    • DNA repair exonuclease rad9 homolog B
    • RAD9 B
    • RAD9 homolog B (S. cerevisiae)
    • RAD9 homolog B (S. pombe)
    • RAD9B
    see all
  • Relevance
    Belongs to the rad9 family.

Images

  • ab165515 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up