Recombinant Human RAET1E protein (Fc Chimera His Tag) (ab227416)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLL GKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQ REAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGL EKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Molecular weight

      50 kDa including tags
    • Amino acids

      31 to 225
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_631904).

Specifications

Our Abpromise guarantee covers the use of ab227416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 85 % SDS-PAGE.
    ab227416 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as ULBP4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • bA350J20.7
    • LETAL
    • Lymphocyte effector toxicity activation ligand
    • MGC125308
    • MGC125309
    • N2DL-4
    • N2DL4
    • N2DL4_HUMAN
    • NKG2D ligand 4
    • NKG2D ligand 4 precursor
    • NKG2DL4
    • RAE-1-like transcript 4
    • RAET1E
    • RAET1E2
    • Retinoic acid early transcript 1E
    • RL-4
    see all
  • Function

    Ligand for the NKG2D receptor. Delivers activating signals to NK cells and promotes tumor immune surveillance by inducing the expansion of anti-tumor cytotoxic lymphocytes.
  • Tissue specificity

    Predominantly expressed in the skin, but also expressed in testis and trachea. Up-regulated in tumor cells of different origins. Expression progressively decreased after treatment of tumor cells with retinoic acid.
  • Sequence similarities

    Belongs to the MHC class I family.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227416.

    MW 57-70 kDa (SDS-PAGE under reducing conditions).

References

ab227416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up