Overview

  • Product name
    Recombinant Human Rag A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHV RFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELE KDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRR LSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEA DEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQ SMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL ERVDGPKHSLLMR
    • Amino acids
      1 to 313
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RRAGA.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenovirus E3 14.7 kDa-interacting protein 1
    • FIP-1
    • Rag A
    • RagA
    • Ras-related GTP-binding protein A
    • RRAGA
    • RRAGA_HUMAN
    see all
  • Function
    Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity. Required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF-alpha signaling pathway leading to induction of cell death. May alternatively act as a cellular target for adenovirus E3-14.7K, an inhibitor of TNF-alpha functions, thereby affecting cell death.
  • Tissue specificity
    Ubiquitously expressed with highest levels of expression in skeletal muscle, heart, and brain.
  • Sequence similarities
    Belongs to the GTR/RAG GTP-binding protein family.
  • Cellular localization
    Cytoplasm. Nucleus. Lysosome. Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state. Colocalizes in vivo with adenovirus E3-14.7K mainly to the cytoplasm especially near the nuclear membrane and in discrete foci on or near the plasma membrane.
  • Information by UniProt

Images

  • ab161103 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up