For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-rage-protein-fc-chimera-active-ab219875.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neurodegenerative disease Alzheimer's disease Amyloid
Share by email
Bioactive grade

Recombinant human RAGE protein (Fc Chimera Active) (ab219875)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human RAGE protein (Fc Chimera Active) (ab219875)
  • Functional Studies - Recombinant human RAGE protein (Fc Chimera Active) (ab219875)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 60% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

ELISA
Product image
Human RAGE ELISA Kit (ab190807)

View more associated products

Description

  • Product name

    Recombinant human RAGE protein (Fc Chimera Active)
    See all RAGE proteins and peptides
  • Biological activity

    Immobilized ab219875 at 20 μg/mL (100 μL/well) can bind Human HMGB1, His Tag  with a linear range of 0.313-5 μg/mL.

  • Purity

    > 60 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    Q15109
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPW DSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPG KPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVS VKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRT APIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWM KDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIE PGEEGPTAGSVGGSGLGTLALA
    • Predicted molecular weight

      61 kDa
    • Amino acids

      23 to 344
    • Additional sequence information

      Extracellular domain with a human IgG1 Fc tag at the C-terminus.

Associated products

  • Related Products

    • Anti-RAGE antibody (ab37647)
    • Anti-RAGE antibody [MM0520-8D11] (ab89911)

Specifications

Our Abpromise guarantee covers the use of ab219875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.75% Glycine, 5% Trehalose, 0.61% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile deionized water to a concentration of 200 µg/ml.

General Info

  • Alternative names

    • Advanced glycosylation end product-specific receptor
    • Ager
    • DAMA 358M23.4
    • MGC2235
    • MGC22357
    • RAGE_HUMAN
    • Receptor for advanced glycation end products
    • Receptor for advanced glycosylation end products
    see all
  • Function

    Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space.
  • Tissue specificity

    Endothelial cells.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Target information above from: UniProt accession Q15109 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human RAGE protein (Fc Chimera Active) (ab219875)
    SDS-PAGE - Recombinant human RAGE protein (Fc Chimera Active) (ab219875)

    ab219875 on SDS-PAGE under reducing (R) conditions. The gel was stained overnight with Coomassie Blue. The protein migrates as 80-90 kDa and 35 kDa Fc fragment under reducing (R) conditions due to glycosylation and auto-cleavage.

  • Functional Studies - Recombinant human RAGE protein (Fc Chimera Active) (ab219875)
    Functional Studies - Recombinant human RAGE protein (Fc Chimera Active) (ab219875)

    Immobilized ab219875 at 20 μg/mL (100 μL/well) can bind Human HMGB1, His Tag with a linear range of 0.313-5 μg/mL.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab219875? Please let us know so that we can cite the reference in this datasheet.

ab219875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab219875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.