Recombinant Human RALA protein (ab102555)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: WB, MS, SDS-PAGE
Description
-
Product name
Recombinant Human RALA protein
See all RALA proteins and peptides -
Purity
> 90 % SDS-PAGE.
ab102555 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAANKPKGQNSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVG NKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIR ARKMEDSKEKNGKKKRKSLAKRIRERC -
Predicted molecular weight
26 kDa including tags -
Amino acids
1 to 203 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab102555 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
Mass Spectrometry
SDS-PAGE
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.00174% PMSF, 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- MGC48949
- RAL
- Ral a
see all -
Function
Multifuntional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Plays a role in the early stages of cytokinesis and is required to tether the exocyst to the cytokinetic furrow. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. Key regulator of LPAR1 signaling and competes with ADRBK1 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells. -
Sequence similarities
Belongs to the small GTPase superfamily. Ras family. -
Post-translational
modificationsPrenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs). -
Cellular localization
Cell surface. Cell membrane. Cleavage furrow. Midbody. Prior to LPA treatment found predominantly at the cell surface and in the presence of LPA co-localizes with LPAR1 and LPAR2 in the endocytic vesicles. During early cytokinesis localizes at the cleavage furrow membrane. Colocalizes with EXOC2 at the early midbody ring and persists there till maturation of the midbody. - Information by UniProt
Images
-
15% SDS-PAGE analysis of 3µg of ab102555.
-
Anti-RALA antibody (ab96759) at 1/3000 dilution +
Recombinant Human RALA protein (ab102555) at 0.01 µg
Secondary
Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Exposure time: 4 minutesab96759 recognizes the full length tagged recombinant protein ab102555 which has an expected molecular weight of 30 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab102555 has been referenced in 1 publication.
- Welsch ME et al. Multivalent Small-Molecule Pan-RAS Inhibitors. Cell 168:878-889.e29 (2017). PubMed: 28235199