Overview

  • Product name

    Recombinant Human RALGDS protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSF TQLDPDLPRPESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYE NESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAF TTTQQVLDLLFKRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDF CQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALS PVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPAPGSELEVAPAPA PELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPSLQ PSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLG SIWSQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARV VEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIF QKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQG TVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSAC NNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNT AIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSA GSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSS SASTTPVAATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGN MYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPE NANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKG IF
    • Molecular weight

      126 kDa including tags
    • Amino acids

      1 to 902
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ral guanine nucleotide dissociation stimulator
    • RalGEF
    • RGF
  • Relevance

    Stimulates the dissociation of GDP from the Ras related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R Ras, H Ras, K Ras, and Rap (from SwissProt).
  • Cellular localization

    Cytoplasmic vesicle

Images

  • 12.5% SDS-PAGE analysis of ab132590 stained with Coomassie Blue.

References

ab132590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up