Description

  • Product name

    Recombinant Human RanBP3 protein
  • Purity

    > 95 % SDS-PAGE.
    ab181938 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSISSSLENSTNSADASSNKFVFGQNMSE RVLSPPKLNEVSSDANRENAAAESGSESSSQEATPEKESLAESAAAYTKA TARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLN DMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMD TEDQGVKVFLISASSKDTGQLYAALHHRILALRS
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      235 to 445
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_015559

Specifications

Our Abpromise guarantee covers the use of ab181938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.88% Sodium chloride, 0.32% Tris HCl

General Info

  • Alternative names

    • DKFZp586I1520
    • Ran binding protein 3
    • Ran-binding protein 3
    • RANB3_HUMAN
    • RanBP3
    see all
  • Function

    Acts as a cofactor for XPO1/CRM1-mediated nuclear export, perhaps as export complex scaffolding protein. Bound to XPO1/CRM1, stabilizes the XPO1/CRM1-cargo interaction. In the absence of Ran-bound GTP prevents binding of XPO1/CRM1 to the nuclear pore complex. Binds to CHC1/RCC1 and increases the guanine nucleotide exchange activity of CHC1/RCC1. Recruits XPO1/CRM1 to CHC1/RCC1 in a Ran-dependent manner. Negative regulator of TGF-beta signaling through interaction with the R-SMAD proteins, SMAD2 and SMAD3, and mediating their nuclear export.
  • Tissue specificity

    Widely expressed with high levels in testis and heart.
  • Sequence similarities

    Contains 1 RanBD1 domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab181938 .

References

ab181938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up