Overview

  • Product name

    Recombinant Human RanGAP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS LEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL ISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLN NCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATAL AEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRVINLNDNTFTE KGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNM AKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQ RGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLG PKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQK AFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDY FPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
    • Molecular weight

      90 kDa including tags
    • Amino acids

      1 to 587

Specifications

Our Abpromise guarantee covers the use of ab131750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fug 1
    • Fug1
    • GTPase-activating protein, RAN, 1
    • KIAA1835
    • MGC20266
    • OTTHUMP00000028918
    • OTTHUMP00000198755
    • OTTHUMP00000198756
    • OTTHUMP00000198757
    • OTTHUMP00000198758
    • RAGP1_HUMAN
    • Ran 1
    • RAN GTPase activating protein 1
    • Ran GTPase-activating protein 1
    • Ran1
    • RANGAP
    • RANGAP 1
    • RanGAP1
    • SD
    • Segregation distorter homolog
    • Segregation distortion
    see all
  • Function

    GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state.
  • Tissue specificity

    Highly expressed in brain, thymus and testis.
  • Sequence similarities

    Belongs to the RNA1 family.
    Contains 6 LRR (leucine-rich) repeats.
  • Post-translational
    modifications

    Phosphorylated occurs before nuclear envelope breakdown and continues throughout mitosis. Phosphorylated by the M-phase kinase cyclin B/Cdk1, in vitro. Differential timimg of dephosphorylation occurs during phases of mitosis. The phosphorylated form remains associated with RANBP2/NUP358 and the SUMO E2-conjugating enzyme, UBC9, on nuclear pore complex (NPC) diassembly and during mitosis.
    Sumoylated with SUMO1. Sumoylation is necessary for targeting to the nuclear envelope (NE), and for association with mitotic spindles and kinetochores during mitosis. Also required for interaction with RANBP2 and is mediated by UBC9.
  • Cellular localization

    Cytoplasm. Nucleus membrane. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle pole. Cytoplasmic during interphase. Targeted to the nuclear rim after sumoylation. During mitosis, associates with mitotic spindles. Association with kinetochores appears soon after nuclear envelope breakdown and persists until late anaphase. Mitotic location also requires sumoylation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131750, stained with Coomassie Blue.

References

ab131750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up