Description

  • Product name

    Recombinant human RANKL protein (Active)
    See all RANKL proteins and peptides
  • Biological activity

    Supports the survival of dendritic cells and osteoclasts.

  • Purity

    > 90 % SDS-PAGE.
    ~28kDa (glycosylated) (SDS-PAGE).
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTF SNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPS SHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDP DQDATYFGAFKVRDID
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      152 to 317
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      Fused at the N-terminus to a linker peptide (6 aa) and a DDDDK-tag.

Specifications

Our Abpromise guarantee covers the use of ab157289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Binds to Human and mouse RANK.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water to a concentration of 0.1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°.

General Info

  • Alternative names

    • CD254
    • hRANKL2
    • ODF
    • OPGL
    • OPTB2
    • Osteoclast differentiation factor
    • Osteoprotegerin ligand
    • RANKL
    • Receptor activator of nuclear factor kappa B ligand
    • Receptor activator of nuclear factor kappa-B ligand
    • sOdf
    • TNF related activation induced cytokine
    • TNF-related activation-induced cytokine
    • TNF11_HUMAN
    • TNFSF 11
    • Tnfsf11
    • TRANCE
    • Tumor necrosis factor (ligand) superfamily member 11
    • Tumor necrosis factor ligand superfamily member 11
    • Tumor necrosis factor ligand superfamily member 11, soluble form
    see all
  • Function

    Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
  • Tissue specificity

    Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
  • Involvement in disease

    Defects in TNFSF11 are the cause of osteopetrosis autosomal recessive type 2 (OPTB2) [MIM:259710]; also known as osteoclast-poor osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts. OPTB2 is characterized by paucity of osteoclasts, suggesting a molecular defect in osteoclast development.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    The soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17.
  • Cellular localization

    Cytoplasm; Secreted and Cell membrane.
  • Information by UniProt

Images

  • Binding of ab157289 to Osteoprotegerin. ab157289 binds to Osteoprotegerin:Fc.

    Method: Ligand binding assay: 96 well ELISA plates were coated O/N with 50 ng OPG-Fc per well. After a blocking step, the indicated concentrations of ab157289 were added for 1 hour. Bound ligand was revealed with an anti-FLAG antibody at 1 µg/ml for 30 minutes, followed by a rabbit anti-mouse IgG-HRP at 1/1000 dilution for 30 minutes. OPD was used as a substrate for the peroxidase. Absorbance was measured at 490 nm in an ELISA reader.

  • SDS-PAGE analysis of ab157289. Lane 1: MWt Marker, Lane 2: ab157289 1µg.
  • Mononuclear cells differentiate into Osteoclasts in the presence of M-CSF and ab157289.

    Method: Human CD14+ mononuclear cells isolated from adult peripheral blood were cultured in control medium (upper panel), in 25ng/ml M-CSF (middle panel), or in 25ng/ml M-CSF plus 50ng/ml ab157289 (lower panel). Osteoclasts were identified as Tartrate-Resistant Acid Phosphatase (TRAP)-positive multinucleated cells. Osteoclasts were detected exclusively in presence of ab157289 and in these culture conditions (M-CSF + ab157289), cells fused and generated multinucleated dark red TRAP-positive cells (arrows). Nuclei were stained with haematoxylin.

References

ab157289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up