For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    recombinant-human-rankl-protein-active-ab157289.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines TNF Superfamily
Share by email
Bioactive grade

Recombinant human RANKL protein (Active) (ab157289)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human RANKL protein (ab157289)
  • SDS-PAGE - Recombinant human RANKL protein (ab157289)
  • Functional Studies - Recombinant human RANKL protein (ab157289)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 90% SDS-PAGE
  • Endotoxin level: < 0.100 Eu/µg
  • Active: Yes
  • Tags: DDDDK tag N-Terminus
  • Suitable for: ELISA, Functional Studies, SDS-PAGE

You may also be interested in

Assay
Product image
JC-10 Mitochondrial Membrane Potential Assay Kit (Microplate) (ab112134)
Biochemical
Product image
JC-1, Mitochondrial membrane potential dye (ab141387)
ELISA
Product image
Human TNFSF11 ELISA Kit (RANKL) (ab213841)

View more associated products

Description

  • Product name

    Recombinant human RANKL protein (Active)
    See all RANKL proteins and peptides
  • Biological activity

    Supports the survival of dendritic cells and osteoclasts.

  • Purity

    > 90 % SDS-PAGE.
    ~28kDa (glycosylated) (SDS-PAGE).
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    O14788
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTF SNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPS SHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDP DQDATYFGAFKVRDID
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      152 to 317
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      Fused at the N-terminus to a linker peptide (6 aa) and a DDDDK-tag.

Associated products

  • Related Products

    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)

Specifications

Our Abpromise guarantee covers the use of ab157289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilized
  • Additional notes

    Binds to Human and mouse RANK.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water to a concentration of 0.1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°.

General Info

  • Alternative names

    • CD254
    • hRANKL2
    • ODF
    • OPGL
    • OPTB2
    • Osteoclast differentiation factor
    • Osteoprotegerin ligand
    • Rank Ligand
    • RANKL
    • Receptor activator of nuclear factor kappa B ligand
    • Receptor activator of nuclear factor kappa-B ligand
    • sOdf
    • TNF related activation induced cytokine
    • TNF-related activation-induced cytokine
    • TNF11_HUMAN
    • TNFSF 11
    • Tnfsf11
    • TRANCE
    • Tumor necrosis factor (ligand) superfamily member 11
    • Tumor necrosis factor ligand superfamily member 11
    • Tumor necrosis factor ligand superfamily member 11, soluble form
    see all
  • Function

    Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
  • Tissue specificity

    Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
  • Involvement in disease

    Defects in TNFSF11 are the cause of osteopetrosis autosomal recessive type 2 (OPTB2) [MIM:259710]; also known as osteoclast-poor osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts. OPTB2 is characterized by paucity of osteoclasts, suggesting a molecular defect in osteoclast development.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    The soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17.
  • Cellular localization

    Cytoplasm; Secreted and Cell membrane.
  • Target information above from: UniProt accession O14788 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human RANKL protein (ab157289)
    Functional Studies - Recombinant human RANKL protein (ab157289)
    Binding of ab157289 to Osteoprotegerin. ab157289 binds to Osteoprotegerin:Fc.

    Method: Ligand binding assay: 96 well ELISA plates were coated O/N with 50 ng OPG-Fc per well. After a blocking step, the indicated concentrations of ab157289 were added for 1 hour. Bound ligand was revealed with an anti-FLAG antibody at 1 µg/ml for 30 minutes, followed by a rabbit anti-mouse IgG-HRP at 1/1000 dilution for 30 minutes. OPD was used as a substrate for the peroxidase. Absorbance was measured at 490 nm in an ELISA reader.

  • SDS-PAGE - Recombinant human RANKL protein (ab157289)
    SDS-PAGE - Recombinant human RANKL protein (ab157289)
    SDS-PAGE analysis of ab157289. Lane 1: MWt Marker, Lane 2: ab157289 1µg.
  • Functional Studies - Recombinant human RANKL protein (ab157289)
    Functional Studies - Recombinant human RANKL protein (ab157289)
    Mononuclear cells differentiate into Osteoclasts in the presence of M-CSF and ab157289.

    Method: Human CD14+ mononuclear cells isolated from adult peripheral blood were cultured in control medium (upper panel), in 25ng/ml M-CSF (middle panel), or in 25ng/ml M-CSF plus 50ng/ml ab157289 (lower panel). Osteoclasts were identified as Tartrate-Resistant Acid Phosphatase (TRAP)-positive multinucleated cells. Osteoclasts were detected exclusively in presence of ab157289 and in these culture conditions (M-CSF + ab157289), cells fused and generated multinucleated dark red TRAP-positive cells (arrows). Nuclei were stained with haematoxylin.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab157289? Please let us know so that we can cite the reference in this datasheet.

ab157289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab157289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.