Overview

  • Product name

    Recombinant Human RAP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ IQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTT VKKFFSASSRVGSKKEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFH KTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVP PERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTP QMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFN AIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTG EDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWS PDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQ DIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPLQPQVYAG
    • Molecular weight

      80 kDa including tags
    • Amino acids

      1 to 491

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • RAB guanine nucleotide exchange factor (GEF) 1
    • Rab5 GDP/GTP exchange factor
    • Rab5ef
    • Rabaptin 5 associated exchange factor for Rab5
    • Rabaptin-5-associated exchange factor for Rab5
    • Rabex 5
    • Rabex-5
    • RABGEF 1
    • Rabgef1
    • RABX 5
    • RABX5
    • RABX5_HUMAN
    • RAP1
    • Rin 2
    • Rin2
    see all
  • Function

    Rab effector protein acting as linker between gamma-adaptin, RAB4A or RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates nucleotide exchange on RAB5A. Can act as a ubiquitin ligase.
  • Sequence similarities

    Contains 1 A20-type zinc finger.
    Contains 1 VPS9 domain.
  • Post-translational
    modifications

    Monoubiquitinated.
  • Cellular localization

    Cytoplasm. Early endosome. Recycling endosome.
  • Information by UniProt

Images

  • ab132711 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up