Recombinant Human RAP1GDS1 protein (ab159309)

Overview

  • Product name
    Recombinant Human RAP1GDS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASG ILQLFATLLTPQSSCKAKVANIIAEVAKNEFMRIPCVDAGLISPLVQLLN SKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHLRSLCSITDP ANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALT EMCLVAFGNLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLA PLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLL LLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDAN CIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKML SAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQEAAEQLGKNVKLVERL VEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMAT SEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPE IKYNSMVLICALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTE QRLTVES
    • Amino acids
      1 to 607
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Exchange factor smgGDS
    • GDP dissociation stimulator 1
    • GDS1
    • GDS1_HUMAN
    • GTP-GDP dissociation stimulator 1
    • GTPase-GDP dissociation stimulator, Rap1, 1
    • Highly similar to RAP1 GTPASE-GDP DISSOCIATION STIMULATOR 1
    • MGC118859
    • MGC118861
    • RAP1
    • Rap1 GTPase-GDP dissociation stimulator 1
    • RAP1GDS1
    • SMG GDS protein
    • SMG P21 stimulatory GDP/GTP exchange protein
    • SMGGDS
    see all
  • Function
    Stimulates GDP/GTP exchange reaction of a group of small GTP-binding proteins (G proteins) including Rap1a/Rap1b, RhoA, RhoB and KRas, by stimulating the dissociation of GDP from and the subsequent binding of GTP to each small G protein.
  • Sequence similarities
    Contains 5 ARM repeats.
  • Information by UniProt

Images

  • ab159309 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up