Overview

  • Product name

    Recombinant Human RAP2B protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMREYKVVVLGSGGVGKSALTVQFVTGS FIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQG FILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVS YGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCC SACVIL
    • Molecular weight

      23 kDa including tags
    • Amino acids

      1 to 183
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab140538 is purified using conventional chromatography techniques
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • MGC20484
    • RAP 2B
    • RAP2A
    • Rap2b
    • RAP2B member of RAS oncogene family
    • RAP2B_HUMAN
    • Ras family small GTP binding protein RAP2B
    • Ras related protein RAP 2B
    • Ras related protein RAP2B
    • Ras-related protein Rap-2b
    • Small GTP binding protein
    see all
  • Function

    Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
  • Tissue specificity

    Expressed in red blood cells (at protein level).
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Domain

    The effector domain mediates the interaction with RUNDC3A.
  • Post-translational
    modifications

    Palmitoylated. Palmitoylation is required for association with recycling endosome membranes and activation of TNIK.
  • Cellular localization

    Recycling endosome membrane. Associated with red blood cells-released vesicles.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab140538.

References

ab140538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up