Description

  • Product name

    Recombinant Human RAP2C protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSP SVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQI VRVKRYEKVPLILVGNKVGLEPEREVMSSEGRALVQEWGCPFMETSAKSK SMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ
    • Amino acids

      1 to 183
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2010200P20Rik
    • AI194294
    • AL022976
    • BOS_25229
    • DKFZp313B211
    • MGC143331
    • OTTHUMP00000024037
    • OTTMUSP00000019067
    • RAP2C
    • RAP2C, member of RAS oncogene family
    • RAP2C_HUMAN
    • Ras related protein Rap 2c
    • Ras-related protein Rap-2c
    • RP23-15D12.2
    see all
  • Function

    Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May play a role in SRE-mediated gene transcription.
  • Tissue specificity

    Expressed in liver, skeletal muscle, prostate, uterus, rectum, stomach, and bladder and to a lower extent in brain, kidney, pancreas, and bone marrow. Expressed in mononuclear leukocytes and megakaryocytes.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications

    Palmitoylated. Palmitoylation is required for association with recycling endosome membranes and activation of TNIK.
  • Cellular localization

    Cytoplasm. Recycling endosome membrane.
  • Information by UniProt

Images

  • ab163662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up