Overview

  • Product name

    Recombinant Human RAPGEF5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGSSRLRVFDPHLERKDSAAALSDRELPLPTFDVPYFKYIDEEDEDDEWS SRSQSSTEDDSVDSLLSDRYVVVSGTPEKILEHLLNDLHLEEVQDKETET LLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHL VSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKIL GMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYIT EHSYVSVKAKVSSIAQEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLNSF FAIVMGLNTASVSRLSQTWEKIPGKFRKLFSELESLTDPSLNHKAYRDAF KKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRH CRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV
    • Amino acids

      1 to 444
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GFR
    • Guanine nucleotide exchange factor for Rap1
    • KIAA0277
    • M Ras regulated Rap GEF
    • M-Ras-regulated GEF
    • M-Ras-regulated Rap GEF
    • MR GEF
    • MR-GEF
    • MRas-regulated guanine nucleotide exchange factor
    • MRGEF
    • Rap guanine nucleotide exchange factor (GEF) 5
    • Rap guanine nucleotide exchange factor 5
    • Rapgef5
    • Related to Epac
    • Repac
    • RPGF5_HUMAN
    see all
  • Function

    Guanine nucleotide exchange factor (GEF) for RAP1A, RAP2A and MRAS/M-Ras-GTP. Its association with MRAS inhibits Rap1 activation.
  • Tissue specificity

    Widely expressed with highest levels in brain.
  • Sequence similarities

    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 Ras-GEF domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab160648 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up