Recombinant Human RAPGEF5 protein (ab160649)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AYRDAFKKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADT VRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV
    • Amino acids
      345 to 444
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GFR
    • Guanine nucleotide exchange factor for Rap1
    • KIAA0277
    • M Ras regulated Rap GEF
    • M-Ras-regulated GEF
    • M-Ras-regulated Rap GEF
    • MR GEF
    • MR-GEF
    • MRas-regulated guanine nucleotide exchange factor
    • MRGEF
    • Rap guanine nucleotide exchange factor (GEF) 5
    • Rap guanine nucleotide exchange factor 5
    • Rapgef5
    • Related to Epac
    • Repac
    • RPGF5_HUMAN
    see all
  • Function
    Guanine nucleotide exchange factor (GEF) for RAP1A, RAP2A and MRAS/M-Ras-GTP. Its association with MRAS inhibits Rap1 activation.
  • Tissue specificity
    Widely expressed with highest levels in brain.
  • Sequence similarities
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 Ras-GEF domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160649 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up