Description

  • Product name

    Recombinant Human RARS protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLK LKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPL LVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNEC IEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSS PNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIA HLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEK ADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAGFGVVLGEDKK KFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAY GCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANI DEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFD ILGIKPVQRM
    • Predicted molecular weight

      99 kDa including tags
    • Amino acids

      1 to 660

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as Arginyl tRNA synthetase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2610011N19Rik
    • 2610037E21Rik
    • AL033339
    • Arginine tRNA ligase
    • Arginine tRNA ligase 1, cytoplasmic
    • Arginine--tRNA ligase
    • Arginyl tRNA synthetase 1
    • Arginyl tRNA synthetase cytoplasmic
    • Arginyl tRNA synthetase, cytoplasmic
    • Arginyl-tRNA synthetase, cytoplasmic
    • ArgRS
    • AW985894
    • DALRD 1
    • DALRD1
    • EC 6.1.1.19
    • MGC8641
    • MGC86730
    • RARS
    • SYRC_HUMAN
    • wu:fa96g09
    • zgc:56050
    • zgc:86730
    see all
  • Function

    Forms part of a macromolecular complex that catalyzes the attachment of specific amino acids to cognate tRNAs during protein synthesis. Modulates the secretion of AIMP1 and may be involved in generation of the inflammatory cytokine EMAP2 from AIMP1.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Domain

    The N-terminus (AA 1-72) has two regions predicted to be alpha-helical that might be involved in the multisynthetase complex assembly.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114873 at approximately 98.71kDa.
    Stained with Coomassie Blue.

References

ab114873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up