Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQ ETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIR QQSETSTHSI
    • Amino acids
      725 to 834
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GAP III
    • GAP1(IP4BP)
    • GAP1IP4BP
    • GAPIII
    • GTPase activating protein 1 family
    • GTPase activating protein III
    • Inositol 1 3 4 5 tetrakisphosphate binding protein
    • Inositol 1345 tetrakisphosphate binding protein
    • Ins P4 binding protein
    • Ins P4-binding protein
    • Ins(1 3 4 5)P4 binding protein
    • Ins(1345)P4 binding protein
    • MGC46517
    • MGC47588
    • Ras GTPase activating protein 3
    • Ras GTPase-activating protein 3
    • RAS p21 protein activator 3
    • RASA 3
    • RASA3
    • RASA3_HUMAN
    see all
  • Function
    Inhibitory regulator of the Ras-cyclic AMP pathway. Binds inositol tetrakisphosphate (IP4) with high affinity. Might be a specific IP4 receptor.
  • Sequence similarities
    Contains 1 Btk-type zinc finger.
    Contains 2 C2 domains.
    Contains 1 PH domain.
    Contains 1 Ras-GAP domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab161434 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up