Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMMKTLSSGNCTLSVPAKNSYRMVVLGA SRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGN HPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKT KEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNT NVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDA YGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
    • Molecular weight

      33 kDa including tags
    • Amino acids

      1 to 266
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_055125.

Specifications

Our Abpromise guarantee covers the use of ab202164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    ab202164 was purified by conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • GTP binding protein Rhes
    • GTP-binding protein Rhes
    • MGC:4834
    • OTTHUMP00000197925
    • Ras homolog enriched in striatum
    • RASD 2
    • RASD family member 2
    • RASD2
    • Rhes
    • RHES_HUMAN
    • TEM 2
    • TEM2
    • Tumor endothelial marker 2
    see all
  • Function

    GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination.
  • Tissue specificity

    Pancreatic endocrine cells (islets of Langerhans).
  • Sequence similarities

    Belongs to the small GTPase superfamily. RasD family.
  • Post-translational
    modifications

    Farnesylated. Farnesylation is required for membrane targeting.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202164.

References

ab202164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up