Overview

  • Product name

    Recombinant Human RASGRP3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTE LAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTE EFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDH LEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNG ISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSH SSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVV PLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAA NFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEM TYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARA PSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGF AKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
    • Molecular weight

      105 kDa including tags
    • Amino acids

      1 to 690

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Calcium and DAG-regulated guanine nucleotide exchange factor III
    • Grp3
    • GRP3_HUMAN
    • Guanine nucleotide exchange factor for Rap1
    • Kiaa0846
    • RAS guanyl releasing protein 3 (calcium and DAG regulated)
    • RAS guanyl releasing protein 3 calcium and DAG regualated guanine nucleotide exchange factor iii
    • Ras guanyl-releasing protein 3
    • RASGRP3
    see all
  • Function

    Guanine nucleotide exchange factor (GEF) for Ras and Rap1.
  • Sequence similarities

    Belongs to the RASGRP family.
    Contains 2 EF-hand domains.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-GEF domain.
  • Information by UniProt

Images

  • ab132245 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up