Description

  • Product name

    Recombinant Human RASL10A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDG AVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDS FDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRR GWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARC SLM
    • Amino acids

      1 to 203
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ras like protein family member 10A
    • Ras like protein RRP22
    • RAS like, family 10, member A
    • RAS related on chromosome 22
    • Ras related protein on chromosome 22
    • Ras related protein on chromosome 22 homolog
    • Ras-like protein family member 10A
    • Ras-like protein RRP22
    • Ras-related protein on chromosome 22
    • RASL 10A
    • Rasl10a
    • RASL10A protein
    • Rasl10a RAS like, family 10, member A
    • RRP 22
    • RRP22
    • RSLAA_HUMAN
    see all
  • Function

    Potent inhibitor of cellular proliferation.
  • Tissue specificity

    Expression appears to be strictly limited to the central nervous system.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications

    Isoprenylation is essential for nucleolar localization, and the proliferation-inhibiting activity of RASL10A.
  • Cellular localization

    Cell membrane. Nucleus > nucleolus. May cycle in and out of the nucleolus in a GTP-dependent manner.
  • Information by UniProt

Images

  • ab161085 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up