Recombinant Human RASSF1 protein (denatured) (ab137136)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Tags: His-DDDDK tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human RASSF1 protein (denatured) -
Purity
> 85 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSGEPELIELRELA PAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTW CDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVE RDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFI KVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHL HVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQ PLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEE HLRQILQKYSYCRQKIQEALHACPLG -
Predicted molecular weight
43 kDa including tags -
Amino acids
1 to 340 -
Tags
His-DDDDK tag N-Terminus
-
-
Description
Recombinant Human RASSF1 protein
Associated products
-
Related Products
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
- Anti-RASSF1 antibody [OTI8E4] (ab119423)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-6X His tag® antibody (ab9108)
Specifications
Our Abpromise guarantee covers the use of ab137136 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- 123F2
- Cardiac specific ras association domain family 1 protein
- cardiac-specific ras association domain family 1 protein, 123F2
see all -
Function
Potential tumor suppressor. Required for death receptor-dependent apoptosis. Mediates activation of STK4 during Fas-induced apoptosis. When associated with MOAP1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation. Isoform A interacts with CDC20, an activator of the anaphase-promoting complex, APC, resulting in the inhibition of APC activity and mitotic progression. Inhibits proliferation by negatively regulating cell cycle progression at the level of G1/S-phase transition by regulating accumulation of cyclin D1 protein. Isoform C has been shown not to perform these roles, no function has been identified for this isoform. Isoform A disrupts interactions among MDM2, DAXX and USP7, thus contributing to the efficient activation of TP53 by promoting MDM2 self-ubiquitination in cell-cycle checkpoint control in response to DNA damage. -
Tissue specificity
Isoform A and isoform C are ubiquitously expressed in all tissues tested, however isoform A is absent in many corresponding cancer cell lines. Isoform B is mainly expressed in hematopoietic cells. -
Sequence similarities
Contains 1 phorbol-ester/DAG-type zinc finger.
Contains 1 Ras-associating domain.
Contains 1 SARAH domain. -
Cellular localization
Nucleus. Predominantly nuclear and Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Nucleus. Localizes to cytoplasmic microtubules during interphase, to bipolar centrosomes associated with microtubules during prophase, to spindle fibers and spindle poles at metaphase and anaphase, to the midzone during early telophase, and to the midbody in late telophase in cells. Colocalizes with MDM2 in the nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab137136 has not yet been referenced specifically in any publications.